- Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 11 (Skint11)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1139632
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 42,262 Da
- E Coli or Yeast
- 29-364
- selection and upkeep of intraepithelial T cells 11
- A630098G03Rik, Gm569
- Selection and upkeep of intraepithelial T-cells protein 11 (Skint11)
Sequence
LDIQINTQIPDTEEGVLVECTAESLFPPAEMTWRDSKGNIIPPSSTFDSQDRAGLLCLKSTILLKNRTEGPITCSIYNKTTNQEKRRSIILSDVLFRPQYMSLMSNNLLYLGIYLIFILFLNFLKGILFCLTKRLVHFRKRMIKIKKVWSNKTRACCPLIWEFLEIVLFIAFLPLYLMFRIRVFTLDEAHILYNNWLWKVCKTLIAMMILFTVLILFLLWTLNRYGKMPCLSSMNIDVSTHDAEQNSSKSAKFQENYDVAGQMILETYEETIFCQHQESCEEYNYDPLLLSSLDALGTCEDEKFSQHQESFEEDEDLQSFSDFKIELYSKLGNLTH